SRSF1 antibody

Catalog No. ABIN629883

Product Details anti-SRSF1 Antibody

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS1 Blocking Peptide, catalog no. 33R-3658, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRSF1

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Alternative Name: SFRS1 (SRSF1 Products)

Background: SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization