DIS3L2 antibody (N-Term)

Catalog No. ABIN630034

This Rabbit Polyclonal antibody specifically detects DIS3L2 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for DIS3L2 antibody (N-Term) (ABIN630034)

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIS3L2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-DIS3L2 Antibody

Binding Specificity: N-Term

Specificity: MGC42174 antibody was raised against the N terminal Of Mgc42174

Purification: Purified

Immunogen: MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC42174 Blocking Peptide, (ABIN5614752), is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIS3L2

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Background: MGC42174 is a probable exonuclease.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Stem Cell Maintenance