Splicing Factor 1 antibody (N-Term)

Catalog No. ABIN630049

This Rabbit Polyclonal antibody specifically detects Splicing Factor 1 in WB and IHC. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for Splicing Factor 1 antibody (N-Term) (ABIN630049)

Target: Splicing Factor 1 (SF1)

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Splicing Factor 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Splicing Factor 1 Antibody

Binding Specificity: N-Term

Specificity: SF1 antibody was raised against the N terminal of SF1

Purification: Purified

Immunogen: SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF1 Blocking Peptide, (ABIN5616082), is also available for use as a blocking control in assays to test for specificity of this SF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Splicing Factor 1

Target: Splicing Factor 1 (SF1)

Alternative Name: SF1

Background: SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location