KCTD18 antibody (N-Term)

Catalog No. ABIN630077

The Rabbit Polyclonal anti-KCTD18 antibody has been validated for WB. It is suitable to detect KCTD18 in samples from Human.

Quick Overview for KCTD18 antibody (N-Term) (ABIN630077)

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCTD18 Antibody

Binding Specificity: N-Term

Specificity: KCTD18 antibody was raised against the N terminal of KCTD18

Purification: Purified

Immunogen: KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD18 Blocking Peptide, (ABIN940421), is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD18

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Alternative Name: KCTD18

Background: The function of Anti-KCTD18 has not yet been determined.

Molecular Weight: 47 kDa (MW of target protein)