POFUT2 antibody (C-Term)

Catalog No. ABIN630165

This anti-POFUT2 antibody is a Rabbit Polyclonal antibody detecting POFUT2 in WB and IHC. Suitable for Human.

Quick Overview for POFUT2 antibody (C-Term) (ABIN630165)

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POFUT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-POFUT2 Antibody

Binding Specificity: C-Term

Specificity: POFUT2 antibody was raised against the C terminal of POFUT2

Purification: Purified

Immunogen: POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POFUT2 Blocking Peptide, (ABIN5615450), is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POFUT2

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Alternative Name: POFUT2

Background: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats.

Molecular Weight: 49 kDa (MW of target protein)