GNAS antibody (C-Term)

Catalog No. ABIN630224

The Rabbit Polyclonal anti-GNAS antibody has been validated for WB. It is suitable to detect GNAS in samples from Human, Mouse, Rat and Dog.

Quick Overview for GNAS antibody (C-Term) (ABIN630224)

Target: GNAS (GNAS Complex Locus (GNAS))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNAS Antibody

Binding Specificity: C-Term

Specificity: GNAS antibody was raised against the C terminal of GNAS

Purification: Purified

Immunogen: GNAS antibody was raised using the C terminal of GNAS corresponding to a region with amino acids YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAS Blocking Peptide, (ABIN936058), is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAS

Target: GNAS (GNAS Complex Locus (GNAS))

Alternative Name: GNAS

Background: This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis