KLK-B1 antibody

Catalog No. ABIN630229

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Human.

Quick Overview for KLK-B1 antibody (ABIN630229)

Target: KLK-B1

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details

Purification: Purified

Immunogen: KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK-B1 Blocking Peptide, (ABIN5614387), is also available for use as a blocking control in assays to test for specificity of this KLK-B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: KLK-B1

Background: Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Molecular Weight: 28 kDa (MW of target protein)