Annexin A13 antibody (N-Term)

Catalog No. ABIN630247

This Rabbit Polyclonal antibody specifically detects Annexin A13 in WB. It exhibits reactivity toward Chemical.

Quick Overview for Annexin A13 antibody (N-Term) (ABIN630247)

Target: Annexin A13 (ANXA13)

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin A13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Annexin A13 Antibody

Binding Specificity: N-Term

Specificity: Annexin A13 antibody was raised against the N terminal of ANXA13

Cross-Reactivity: Human, Dog (Canine)

Purification: Purified

Immunogen: Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A13 Blocking Peptide, (ABIN939869), is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin A13

Target: Annexin A13 (ANXA13)

Alternative Name: Annexin A13

Target Type: Chemical

Background: The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Molecular Weight: 39 kDa (MW of target protein)