CLDN10 antibody (C-Term)
-
- Target See all CLDN10 Antibodies
- CLDN10 (Claudin 10 (CLDN10))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLDN10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Claudin 10 antibody was raised against the C terminal of CLDN10
- Purification
- Purified
- Immunogen
- Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
- Top Product
- Discover our top product CLDN10 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 10 Blocking Peptide, catalog no. 33R-5765, is also available for use as a blocking control in assays to test for specificity of this Claudin 10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLDN10 (Claudin 10 (CLDN10))
- Alternative Name
- Claudin 10 (CLDN10 Products)
- Background
- CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Hepatitis C
-