CLDN8 antibody (C-Term)

Catalog No. ABIN630268

This Rabbit Polyclonal antibody specifically detects CLDN8 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for CLDN8 antibody (C-Term) (ABIN630268)

Target: CLDN8 (Claudin 8 (CLDN8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLDN8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CLDN8 Antibody

Binding Specificity: C-Term

Specificity: Claudin 8 antibody was raised against the C terminal of CLDN8

Purification: Purified

Immunogen: Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV

Application Details

Application Notes: WB: 0.5-1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 8 Blocking Peptide, (ABIN939584), is also available for use as a blocking control in assays to test for specificity of this Claudin 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLDN8

Target: CLDN8 (Claudin 8 (CLDN8))

Alternative Name: Claudin 8

Background: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Hepatitis C