OR6C70 antibody (C-Term)

Catalog No. ABIN630295

This Rabbit Polyclonal antibody specifically detects OR6C70 in WB. It exhibits reactivity toward Human.

Quick Overview for OR6C70 antibody (C-Term) (ABIN630295)

Target: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR6C70 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OR6C70 Antibody

Binding Specificity: C-Term

Specificity: OR6 C70 antibody was raised against the C terminal of OR6 70

Purification: Purified

Immunogen: OR6 C70 antibody was raised using the C terminal of OR6 70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR6C70 Blocking Peptide, (ABIN938938), is also available for use as a blocking control in assays to test for specificity of this OR6C70 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR6C70

Target: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Alternative Name: OR6C70

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molecular Weight: 34 kDa (MW of target protein)