MGC39633 (N-Term) antibody

Catalog No. ABIN630310

This Rabbit Polyclonal antibody specifically detects in IHC and WB. It exhibits reactivity toward Human and Dog.

Quick Overview for MGC39633 (N-Term) antibody (ABIN630310)

Target: MGC39633

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: MGC39633 antibody was raised against the N terminal Of Mgc39633

Purification: Purified

Immunogen: MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC39633 Blocking Peptide, (ABIN5614748), is also available for use as a blocking control in assays to test for specificity of this MGC39633 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC39633 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC39633

Background: The function of MGC39633 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 62 kDa (MW of target protein)