COX IV antibody (N-Term)

Catalog No. ABIN630318

Product Details anti-COX IV Antibody

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX IV antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: COX4 I1 antibody was raised against the N terminal of COX4 1

Purification: Purified

Immunogen: COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX4I1 Blocking Peptide, catalog no. 33R-1282, is also available for use as a blocking control in assays to test for specificity of this COX4I1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX IV

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Alternative Name: COX4I1 (COX4I1 Products)

Background: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Proton Transport