SLC22A16 antibody

Catalog No. ABIN630397

This Rabbit Polyclonal antibody specifically detects SLC22A16 in IHC and WB. It exhibits reactivity toward Human.

Quick Overview for SLC22A16 antibody (ABIN630397)

Target: SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A16 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-SLC22A16 Antibody

Purification: Purified

Immunogen: SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A16 Blocking Peptide, (ABIN937202), is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A16

Target: SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))

Alternative Name: SLC22A16

Background: Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).

Molecular Weight: 63 kDa (MW of target protein)