FADS1 antibody (C-Term)

Catalog No. ABIN630410

The Rabbit Polyclonal anti-FADS1 antibody has been validated for WB and IHC. It is suitable to detect FADS1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for FADS1 antibody (C-Term) (ABIN630410)

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FADS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-FADS1 Antibody

Binding Specificity: C-Term

Specificity: FADS1 antibody was raised against the C terminal of FADS1

Purification: Purified

Immunogen: FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FADS1 Blocking Peptide, (ABIN938388), is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FADS1

Target: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Alternative Name: FADS1

Background: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha