SLC35B1 antibody (C-Term)

Catalog No. ABIN630422

The Rabbit Polyclonal anti-SLC35B1 antibody has been validated for WB. It is suitable to detect SLC35B1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for SLC35B1 antibody (C-Term) (ABIN630422)

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC35B1 Antibody

Binding Specificity: C-Term

Specificity: SLC35 B1 antibody was raised against the C terminal of SLC35 1

Purification: Purified

Immunogen: SLC35 B1 antibody was raised using the C terminal of SLC35 1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35B1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35B1

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Alternative Name: SLC35B1

Background: SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Molecular Weight: 35 kDa (MW of target protein)