ST6GALNAC5 antibody (Middle Region)
-
- Target See all ST6GALNAC5 Antibodies
- ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST6GALNAC5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ST6 GALNAC5 antibody was raised against the middle region of ST6 ALNAC5
- Purification
- Purified
- Immunogen
- ST6 GALNAC5 antibody was raised using the middle region of ST6 ALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
- Top Product
- Discover our top product ST6GALNAC5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST6GALNAC5 Blocking Peptide, catalog no. 33R-1167, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))
- Alternative Name
- ST6GALNAC5 (ST6GALNAC5 Products)
- Background
- ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.
- Molecular Weight
- 38 kDa (MW of target protein)
-