RORA antibody (Middle Region)
-
- Target See all RORA Antibodies
- RORA (RAR-Related Orphan Receptor A (RORA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RORA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RORA antibody was raised against the middle region of RORA
- Purification
- Affinity purified
- Immunogen
- RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI
- Top Product
- Discover our top product RORA Primary Antibody
-
anti-RAR-Related Orphan Receptor A (RORA) (AA 193-222) antibody
RORA Reactivity: Human WB, IF, FACS Host: Rabbit Polyclonal RB16632 unconjugated
anti-RAR-Related Orphan Receptor A (RORA) antibodyKO Validated RORA Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (Middle Region) antibodyRORA Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Guinea Pig, Goat, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (N-Term) antibodyRORA Reactivity: Human, Rat WB, ELISA, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (Hinge Region) antibodyRORA Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Monkey, Pig, Bat, Hamster IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) antibodyRORA Reactivity: Human, Mouse WB, IF Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (Ligand Binding Domain) antibodyRORA Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Monkey, Pig, Bat IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (AA 50-99) antibodyRORA Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (AA 239-288) antibodyRORA Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Guinea Pig, Monkey, Goat, Pig, Zebrafish (Danio rerio), Bat, Sheep, Chicken WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAR-Related Orphan Receptor A (RORA) (AA 1-468) antibodyRORA Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RORA Blocking Peptide, catalog no. 33R-7096, is also available for use as a blocking control in assays to test for specificity of this RORA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RORA (RAR-Related Orphan Receptor A (RORA))
- Alternative Name
- RORA (RORA Products)
- Background
- The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-
