PAX8 antibody (N-Term)

Catalog No. ABIN630533

The Rabbit Polyclonal anti-PAX8 antibody has been validated for WB. It is suitable to detect PAX8 in samples from Human, Mouse, Rat and Dog.

Quick Overview for PAX8 antibody (N-Term) (ABIN630533)

Target: PAX8 (Paired Box 8 (PAX8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAX8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAX8 Antibody

Binding Specificity: N-Term

Specificity: PAX8 antibody was raised against the N terminal of PAX8

Purification: Affinity purified

Immunogen: PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAX8 Blocking Peptide, (ABIN940042), is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAX8

Target: PAX8 (Paired Box 8 (PAX8))

Alternative Name: PAX8

Background: PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation