LOC441956 antibody (N-Term)

Catalog No. ABIN630537

This anti-LOC441956 antibody is a Rabbit Polyclonal antibody detecting LOC441956 in WB. Suitable for Human.

Quick Overview for LOC441956 antibody (N-Term) (ABIN630537)

Target: LOC441956 (Hypothetical LOC441956 (LOC441956))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-LOC441956 Antibody

Binding Specificity: N-Term

Specificity: LOC441956 antibody was raised against the N terminal of LOC441956

Purification: Affinity purified

Immunogen: LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC441956 Blocking Peptide, (ABIN936804), is also available for use as a blocking control in assays to test for specificity of this LOC441956 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC441956 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC441956

Target: LOC441956 (Hypothetical LOC441956 (LOC441956))

Alternative Name: LOC441956

Background: The function of LOC441956 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 15 kDa (MW of target protein)