CBP antibody
-
- Target See all CBP (CREBBP) Antibodies
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
- Top Product
- Discover our top product CREBBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CREBBP Blocking Peptide, catalog no. 33R-9216, is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
- Alternative Name
- CREBBP (CREBBP Products)
- Background
- CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.
- Molecular Weight
- 261 kDa (MW of target protein)
- Pathways
- TCR Signaling, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-