CBP antibody

Catalog No. ABIN630600

This anti-CBP antibody is a Rabbit Polyclonal antibody detecting CBP in WB. Suitable for Human, Mouse and Rat.

Quick Overview for CBP antibody (ABIN630600)

Target: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CBP Antibody

Purification: Affinity purified

Immunogen: CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CREBBP Blocking Peptide, (ABIN5612996), is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CBP

Target: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Alternative Name: CREBBP

Background: CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.

Molecular Weight: 261 kDa (MW of target protein)

Pathways: TCR Signaling, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha