GNAL antibody

Catalog No. ABIN630618

This anti-GNAL antibody is a Rabbit Polyclonal antibody detecting GNAL in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GNAL antibody (ABIN630618)

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNAL Antibody

Purification: Affinity purified

Immunogen: GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAL Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GNAL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAL

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Alternative Name: GNAL

Background: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Molecular Weight: 50 kDa (MW of target protein)