NUP35 antibody (C-Term)

Catalog No. ABIN630746

The Rabbit Polyclonal anti-NUP35 antibody has been validated for WB. It is suitable to detect NUP35 in samples from Human, Mouse and Rat.

Quick Overview for NUP35 antibody (C-Term) (ABIN630746)

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP35 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NUP35 Antibody

Binding Specificity: C-Term

Specificity: NUP35 antibody was raised against the C terminal of NUP35

Purification: Affinity purified

Immunogen: NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP35 Blocking Peptide, (ABIN5615086), is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP35

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Alternative Name: NUP35

Background: NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Molecular Weight: 35 kDa (MW of target protein)