NUP43 antibody (Middle Region)

Catalog No. ABIN630751

This Rabbit Polyclonal antibody specifically detects NUP43 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NUP43 antibody (Middle Region) (ABIN630751)

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP43 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NUP43 Antibody

Binding Specificity: Middle Region

Specificity: NUP43 antibody was raised against the middle region of NUP43

Purification: Affinity purified

Immunogen: NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP43 Blocking Peptide, (ABIN939216), is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP43

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Alternative Name: NUP43

Background: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Molecular Weight: 42 kDa (MW of target protein)