RALGPS2 antibody (N-Term)

Catalog No. ABIN630757

This Rabbit Polyclonal antibody specifically detects RALGPS2 in WB. It exhibits reactivity toward Human.

Quick Overview for RALGPS2 antibody (N-Term) (ABIN630757)

Target: RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALGPS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RALGPS2 Antibody

Binding Specificity: N-Term

Specificity: RALGPS2 antibody was raised against the n terminal of RALGPS2

Purification: Affinity purified

Immunogen: RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALGPS2 Blocking Peptide, (ABIN5615748), is also available for use as a blocking control in assays to test for specificity of this RALGPS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALGPS2

Target: RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))

Alternative Name: RALGPS2

Background: RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Molecular Weight: 32 kDa (MW of target protein)