HSPA4 antibody (Middle Region)

Catalog No. ABIN630854

The Rabbit Polyclonal anti-HSPA4 antibody has been validated for WB. It is suitable to detect HSPA4 in samples from Human, Mouse, Rat and Dog.

Quick Overview for HSPA4 antibody (Middle Region) (ABIN630854)

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPA4 Antibody

Binding Specificity: Middle Region

Specificity: HSPA4 antibody was raised against the middle region of HSPA4

Purification: Affinity purified

Immunogen: HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA4 Blocking Peptide, (ABIN5614099), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Alternative Name: HSPA4

Background: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Molecular Weight: 94 kDa (MW of target protein)