NP (Middle Region) antibody

Catalog No. ABIN630859

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Human.

Quick Overview for NP (Middle Region) antibody (ABIN630859)

Target: NP

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: NP antibody was raised against the middle region of NP

Purification: Affinity purified

Immunogen: NP antibody was raised using the middle region of NP corresponding to a region with amino acids GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NP Blocking Peptide, (ABIN939017), is also available for use as a blocking control in assays to test for specificity of this NP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: NP

Target Type: Viral Protein

Background: Defects in NP are the cause of nucleoside phosphorylase deficiency (NP deficiency). It leads to a severe T-cell immunodeficiency with neurologic disorder in children. The specific function of NP is not yet known.

Molecular Weight: 32 kDa (MW of target protein)