PECI/ECI2 antibody (Middle Region)

Catalog No. ABIN630872

The Rabbit Polyclonal anti-PECI/ECI2 antibody has been validated for WB. It is suitable to detect PECI/ECI2 in samples from Human and Rat.

Quick Overview for PECI/ECI2 antibody (Middle Region) (ABIN630872)

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PECI/ECI2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PECI/ECI2 Antibody

Binding Specificity: Middle Region

Specificity: PECI antibody was raised against the middle region of PECI

Purification: Affinity purified

Immunogen: PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PECI Blocking Peptide, (ABIN936981), is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PECI/ECI2

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Alternative Name: PECI

Background: PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

Molecular Weight: 40 kDa (MW of target protein)