OPTN antibody (C-Term)

Catalog No. ABIN631194

This anti-OPTN antibody is a Rabbit Polyclonal antibody detecting OPTN in WB. Suitable for Human, Mouse and Rat.

Quick Overview for OPTN antibody (C-Term) (ABIN631194)

Target: OPTN (Optineurin (OPTN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OPTN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OPTN Antibody

Binding Specificity: C-Term

Specificity: Optineurin antibody was raised against the C terminal of OPTN

Purification: Affinity purified

Immunogen: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Optineurin Blocking Peptide, (ABIN5615129), is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OPTN

Target: OPTN (Optineurin (OPTN))

Alternative Name: Optineurin

Background: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: M Phase