UMPS antibody (C-Term)

Catalog No. ABIN631243

This Rabbit Polyclonal antibody specifically detects UMPS in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for UMPS antibody (C-Term) (ABIN631243)

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UMPS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UMPS Antibody

Binding Specificity: C-Term

Specificity: UMPS antibody was raised against the C terminal of UMPS

Purification: Affinity purified

Immunogen: UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UMPS Blocking Peptide, (ABIN5616907), is also available for use as a blocking control in assays to test for specificity of this UMPS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UMPS

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Alternative Name: UMPS

Background: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process