STUB1 antibody (C-Term)

Catalog No. ABIN631354

This Rabbit Polyclonal antibody specifically detects STUB1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for STUB1 antibody (C-Term) (ABIN631354)

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STUB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STUB1 Antibody

Binding Specificity: C-Term

Specificity: STUB1 antibody was raised against the C terminal of STUB1

Purification: Affinity purified

Immunogen: STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STUB1 Blocking Peptide, catalog no. 33R-9459, is also available for use as a blocking control in assays to test for specificity of this STUB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STUB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STUB1

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Alternative Name: STUB1

Background: STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Response to Water Deprivation