Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) antibody

Catalog No. ABIN631415

The Rabbit Polyclonal anti- antibody has been validated for WB. It is suitable to detect in samples from Human, Mouse and Rat.

Quick Overview for Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) antibody (ABIN631415)

Target: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: HS3 ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS3ST6 Blocking Peptide, (ABIN938635), is also available for use as a blocking control in assays to test for specificity of this HS3ST6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Alternative Name: HS3ST6

Background: HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process