Peroxiredoxin 6 antibody (C-Term)

Catalog No. ABIN631527

This anti-Peroxiredoxin 6 antibody is a Rabbit Polyclonal antibody detecting Peroxiredoxin 6 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Peroxiredoxin 6 antibody (C-Term) (ABIN631527)

Target: Peroxiredoxin 6 (PRDX6)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Peroxiredoxin 6 Antibody

Binding Specificity: C-Term

Specificity: PRDX6 antibody was raised against the C terminal of PRDX6

Purification: Affinity purified

Immunogen: PRDX6 antibody was raised using the C terminal of PRDX6 corresponding to a region with amino acids VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX6 Blocking Peptide, (ABIN5615540), is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 6

Target: Peroxiredoxin 6 (PRDX6)

Alternative Name: PRDX6

Background: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Molecular Weight: 25 kDa (MW of target protein)