IGD1 antibody (Middle Region)

Catalog No. ABIN631560

This anti-IGD1 antibody is a Rabbit Polyclonal antibody detecting IGD1 in WB. Suitable for Human.

Quick Overview for IGD1 antibody (Middle Region) (ABIN631560)

Target: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-IGD1 Antibody

Binding Specificity: Middle Region

Specificity: TIGD1 antibody was raised against the middle region of TIGD1

Purification: Affinity purified

Immunogen: TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIGD1 Blocking Peptide, (ABIN5616601), is also available for use as a blocking control in assays to test for specificity of this TIGD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGD1

Target: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Alternative Name: IGD1

Background: TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.

Molecular Weight: 67 kDa (MW of target protein)