Keratin 84 antibody (Middle Region)

Catalog No. ABIN631575

This anti-Keratin 84 antibody is a Rabbit Polyclonal antibody detecting Keratin 84 in WB. Suitable for Human.

Quick Overview for Keratin 84 antibody (Middle Region) (ABIN631575)

Target: Keratin 84 (KRT84)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Keratin 84 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Keratin 84 Antibody

Binding Specificity: Middle Region

Specificity: Cytokeratin 84 antibody was raised against the middle region of KRT84

Purification: Affinity purified

Immunogen: Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 84 Blocking Peptide, (ABIN938140), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 84 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT84 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Keratin 84

Target: Keratin 84 (KRT84)

Background: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails.

Molecular Weight: 65 kDa (MW of target protein)