ERI2 antibody (N-Term)

Catalog No. ABIN631685

The Rabbit Polyclonal anti-ERI2 antibody has been validated for WB. It is suitable to detect ERI2 in samples from Human.

Quick Overview for ERI2 antibody (N-Term) (ABIN631685)

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERI2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERI2 Antibody

Binding Specificity: N-Term

Specificity: EXOD1 antibody was raised against the N terminal Of Exod1

Purification: Affinity purified

Immunogen: EXOD1 antibody was raised using the N terminal Of Exod1 corresponding to a region with amino acids GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOD1 Blocking Peptide, (ABIN938883), is also available for use as a blocking control in assays to test for specificity of this EXOD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERI2

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Alternative Name: EXOD1

Background: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Molecular Weight: 37 kDa (MW of target protein)