ERI2 antibody (Middle Region)

Catalog No. ABIN631686

This anti-ERI2 antibody is a Rabbit Polyclonal antibody detecting ERI2 in WB. Suitable for Human and Mouse.

Quick Overview for ERI2 antibody (Middle Region) (ABIN631686)

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERI2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERI2 Antibody

Binding Specificity: Middle Region

Specificity: ERI2 antibody was raised against the middle region of ERI2

Purification: Affinity purified

Immunogen: ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERI2 Blocking Peptide, (ABIN5613396), is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERI2

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Alternative Name: ERI2

Background: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Molecular Weight: 37 kDa (MW of target protein)