HP1BP3 antibody (Middle Region)

Catalog No. ABIN631715

The Rabbit Polyclonal anti-HP1BP3 antibody has been validated for WB. It is suitable to detect HP1BP3 in samples from Human, Mouse and Rat.

Quick Overview for HP1BP3 antibody (Middle Region) (ABIN631715)

Target: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HP1BP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HP1BP3 Antibody

Binding Specificity: Middle Region

Specificity: HP1 BP3 antibody was raised against the middle region of HP1 P3

Purification: Affinity purified

Immunogen: HP1 BP3 antibody was raised using the middle region of HP1 P3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HP1BP3 Blocking Peptide, (ABIN5614063), is also available for use as a blocking control in assays to test for specificity of this HP1BP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HP1BP3

Target: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Alternative Name: HP1BP3

Background: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Molecular Weight: 61 kDa (MW of target protein)