GNPDA1 antibody (C-Term)

Catalog No. ABIN631844

The Rabbit Polyclonal anti-GNPDA1 antibody has been validated for WB. It is suitable to detect GNPDA1 in samples from Human, Mouse, Rat and C. elegans.

Quick Overview for GNPDA1 antibody (C-Term) (ABIN631844)

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNPDA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNPDA1 Antibody

Binding Specificity: C-Term

Specificity: GNPDA1 antibody was raised against the C terminal of GNPDA1

Purification: Affinity purified

Immunogen: GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNPDA1 Blocking Peptide, (ABIN937835), is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNPDA1

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Alternative Name: GNPDA1

Background: GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

Molecular Weight: 33 kDa (MW of target protein)