Nop10 antibody (Middle Region)

Catalog No. ABIN631878

This anti-Nop10 antibody is a Rabbit Polyclonal antibody detecting Nop10 in WB. Suitable for Human.

Quick Overview for Nop10 antibody (Middle Region) (ABIN631878)

Target: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nop10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nop10 Antibody

Binding Specificity: Middle Region

Specificity: NOLA3 antibody was raised against the middle region of Nola3

Purification: Affinity purified

Immunogen: NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOLA3 Blocking Peptide, (ABIN5615023), is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nop10

Target: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Alternative Name: NOLA3

Background: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Molecular Weight: 8 kDa (MW of target protein)