PAOX antibody

Catalog No. ABIN631893

This anti-PAOX antibody is a Rabbit Polyclonal antibody detecting PAOX in WB. Suitable for Human.

Quick Overview for PAOX antibody (ABIN631893)

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAOX antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAOX Antibody

Purification: Affinity purified

Immunogen: PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAOX Blocking Peptide, (ABIN939236), is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAOX

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Alternative Name: PAOX

Background: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine.

Molecular Weight: 56 kDa (MW of target protein)