MVK antibody (N-Term)

Catalog No. ABIN631917

This anti-MVK antibody is a Rabbit Polyclonal antibody detecting MVK in WB. Suitable for Human, Mouse and Rat.

Quick Overview for MVK antibody (N-Term) (ABIN631917)

Target: MVK (Mevalonate Kinase (MVK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MVK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MVK Antibody

Binding Specificity: N-Term

Specificity: MVK antibody was raised against the N terminal of MVK

Purification: Affinity purified

Immunogen: MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MVK Blocking Peptide, (ABIN940193), is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MVK

Target: MVK (Mevalonate Kinase (MVK))

Alternative Name: MVK

Background: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Molecular Weight: 42 kDa (MW of target protein)