ANKRD5 antibody (N-Term)

Catalog No. ABIN631952

The Rabbit Polyclonal anti-ANKRD5 antibody has been validated for WB. It is suitable to detect ANKRD5 in samples from Human.

Quick Overview for ANKRD5 antibody (N-Term) (ABIN631952)

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKRD5 Antibody

Binding Specificity: N-Term

Specificity: ANKRD5 antibody was raised against the N terminal of ANKRD5

Purification: Affinity purified

Immunogen: ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD5 Blocking Peptide, (ABIN5612069), is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD5

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Alternative Name: ANKRD5

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 87 kDa (MW of target protein)