DPH2 antibody

Catalog No. ABIN631965

This anti-DPH2 antibody is a Rabbit Polyclonal antibody detecting DPH2 in WB. Suitable for Human.

Quick Overview for DPH2 antibody (ABIN631965)

Target: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPH2 Antibody

Purification: Affinity purified

Immunogen: DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPH2 Blocking Peptide, (ABIN937132), is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPH2

Target: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Alternative Name: DPH2

Background: This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2.

Molecular Weight: 52 kDa (MW of target protein)