BRIX1 antibody (Middle Region)
-
- Target See all BRIX1 Antibodies
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BRIX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BXDC2 antibody was raised against the middle region of Bxdc2
- Purification
- Affinity purified
- Immunogen
- BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA
- Top Product
- Discover our top product BRIX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BXDC2 Blocking Peptide, catalog no. 33R-1351, is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
- Alternative Name
- BXDC2 (BRIX1 Products)
- Background
- BXDC2 is required for biogenesis of the 60S ribosomal subunit.
- Molecular Weight
- 41 kDa (MW of target protein)
-