EXD3 antibody (N-Term)

Catalog No. ABIN631991

The Rabbit Polyclonal anti-EXD3 antibody has been validated for WB. It is suitable to detect EXD3 in samples from Human.

Quick Overview for EXD3 antibody (N-Term) (ABIN631991)

Target: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXD3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXD3 Antibody

Binding Specificity: N-Term

Specificity: FLJ20433 antibody was raised against the N terminal of FLJ20433

Purification: Affinity purified

Immunogen: FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ20433 Blocking Peptide, (ABIN5613606), is also available for use as a blocking control in assays to test for specificity of this FLJ20433 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20433 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXD3

Target: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Background: The specific function of FLJ20433 is not yet known.

Molecular Weight: 83 kDa (MW of target protein)