Caldesmon antibody (C-Term)

Catalog No. ABIN631993

This Rabbit Polyclonal antibody specifically detects Caldesmon in WB. It exhibits reactivity toward Human.

Quick Overview for Caldesmon antibody (C-Term) (ABIN631993)

Target: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Caldesmon antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Caldesmon Antibody

Binding Specificity: C-Term

Specificity: Caldesmon 1 antibody was raised against the C terminal of CALD1

Purification: Affinity purified

Immunogen: Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Caldesmon 1 Blocking Peptide, (ABIN5612578), is also available for use as a blocking control in assays to test for specificity of this Caldesmon 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Caldesmon

Target: Caldesmon (CALD1) (Caldesmon 1 (CALD1))

Alternative Name: Caldesmon 1

Background: CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction