ALDH1L1 antibody (Middle Region)
-
- Target See all ALDH1L1 Antibodies
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALDH1L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALDH1 L1 antibody was raised against the middle region of ALDH1 1
- Purification
- Affinity purified
- Immunogen
- ALDH1 L1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
- Top Product
- Discover our top product ALDH1L1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
- Alternative Name
- ALDH1L1 (ALDH1L1 Products)
- Background
- ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
- Molecular Weight
- 99 kDa (MW of target protein)
-