Acylglycerol Kinase antibody (N-Term)

Catalog No. ABIN632105

The Rabbit Polyclonal anti-Acylglycerol Kinase antibody has been validated for WB. It is suitable to detect Acylglycerol Kinase in samples from Human.

Quick Overview for Acylglycerol Kinase antibody (N-Term) (ABIN632105)

Target: Acylglycerol Kinase (AGK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acylglycerol Kinase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Acylglycerol Kinase Antibody

Binding Specificity: N-Term

Specificity: AGK antibody was raised against the N terminal of AGK

Purification: Affinity purified

Immunogen: AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGK Blocking Peptide, (ABIN939868), is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acylglycerol Kinase

Target: Acylglycerol Kinase (AGK)

Alternative Name: AGK

Background: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Molecular Weight: 47 kDa (MW of target protein)