CCDC63 antibody (Middle Region)

Catalog No. ABIN632141

The Rabbit Polyclonal anti-CCDC63 antibody has been validated for WB. It is suitable to detect CCDC63 in samples from Human, Rat and Mouse.

Quick Overview for CCDC63 antibody (Middle Region) (ABIN632141)

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC63 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC63 Antibody

Binding Specificity: Middle Region

Specificity: CCDC63 antibody was raised against the middle region of CCDC63

Purification: Affinity purified

Immunogen: CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC63 Blocking Peptide, (ABIN938065), is also available for use as a blocking control in assays to test for specificity of this CCDC63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC63

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Alternative Name: CCDC63

Background: The function of CCDC63 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 66 kDa (MW of target protein)